Reisebeschreibung - DDDEasy

Wortinformationen

Artikel: die
Wort: Reisebeschreibung
Typ: Substantiv
Silbentrennung: Rei•se•be•schrei•bung
Plural: die Reisebeschreibungen
Duden geprüft:     Reisebeschreibung Duden   Reisebeschreibung Wiktionary
Wörter, die mit "-ung" enden, haben fast immer Artikel: die.
DER: 127 Ausnahmen Beispiele
DIE: 11 043
DAS: 2 Ausnahmen Beispiele
Kompositum:

Reise

- [WIKI] Der Begriff Reise bedeutet im Sinne der Verkehrswirtschaft die Fortbewegung von Personen über eine längere Zeit zu Fuß oder mit Verkehrsmitteln außerhalb des Wirtschaftsverkehrs, um ein einzelnes Ziel zu erreichen oder mehrere Orte kennenzulernen (Rundreise). Im fremdenverkehrswirtschaftlichen Sinne umfasst eine Reise sowohl die Ortsveränderung selbst als auch den Aufenthalt am Zielort. Die verwendeten Verkehrsmittel bilden hierbei eine sogenannte Reisekette (wie beispielsweise Bus – Flu...

Beschreibung

[1] Aufzählung oder Schilderung von Merkmalen und Eigenschaften von etwas/jemandem   [2] textliches Beschreiben eines Blatts Papier oder einer digitalen Datei etc.  
Baustein von: Reisebeschreibungen
PowerIndex: 3
Häufigkeit: 4 von 10
Wörter mit Endung -reisebeschreibung: 1
Wörter mit Endung -reisebeschreibung aber mit einem anderen Artikel die : 0
92% unserer Spielapp-Nutzer haben den Artikel korrekt erraten.

Reisebeschreibung Definition

Bedeutung - Reisebeschreibung

[1] Schilderung der Sehenswürdigkeiten, der Besonderheiten von Land und Leuten sowie der persönlichen Erlebnisse auf einer Reise in schriftlicher und illustrierter Form oder als Hörbuch   [2] Beschreibung, Erzählung, Roman : Reisebericht, Reisebeschreibung, Reisebuch  

Reisebeschreibung Wiki

Als Reisebericht oder Reisebes
Author:
Lizenz: Public domain
Bild:Wikimedia
Wortbeschreibung : Wikipedia

Als Reisebericht oder Reisebeschreibung bezeichnet man die (literarische) Darstellung der Beobachtungen und Erlebnisse eines Reisenden. Solche Beschreibungen variieren sehr in Inhalt und Wert, je nach Zweck der jeweiligen Reise. Sie sind oft reich illustriert. Mehr lesen

Konjunktion

Singular
Nominativ die Reisebeschreibung
Akkusativ die Reisebeschreibung
Dativ der Reisebeschreibung
Genitiv der Reisebeschreibung
Plural
Nominativ die Reisebeschreibungen
Akkusativ die Reisebeschreibungen
Dativ den Reisebeschreibungen
Genitiv der Reisebeschreibungen

Bilder von "Reisebeschreibung"

 Titelblatt einer Reisebeschreibung aus 1893
Title :Nauman-Horn
Bedeutung: 1
Beschreibung: Titelblatt einer Reisebeschreibung aus 1893
Author: Edmund Naumann
Lizenz: pd

Phrasen mit "Reisebeschreibung"

Mehr

Übersetzung

Bedeutung Deutsch Übersetzung Sprache Artikel Aussprache
1 Reisebeschreibung περὶ τῆς ἀποδημίας συγγραφή   grc f peri tēs apodēmias syngraphē
1 Reisebeschreibung travel book  en
Reisebeschreibung book of travel  en
Reisebeschreibung travelogue  en
Reisebeschreibung itinerary  en
Reisebeschreibung description of a journey  en
1 Reisebeschreibung récit de voyage  fr m
1 Reisebeschreibung οδοιπορικό   el n odiporikó
1 Reisebeschreibung descrizione di viaggio  it f
Reisebeschreibung descrizione di un viaggio  it f
Reisebeschreibung descrizione del viaggio  it f
1 Reisebeschreibung putopis  hr
Reisebeschreibung putopisni opis  hr
1 Reisebeschreibung reisbeschrijving  nl f
Reisebeschreibung reisverhaal  nl n
1 Reisebeschreibung dziennik podróży  pl m
1 Reisebeschreibung описание путешествия   ru n opisanije putjeschjestwija
Reisebeschreibung отчёт о поездке   ru m ottschjot o pojesdkje
1 Reisebeschreibung potopis  sl
1 Reisebeschreibung descripción de un viaje  es f
1 Reisebeschreibung cestopis  cs m
1 Reisebeschreibung seyahat rehberi  tr
Reisebeschreibung yolculuk rehberi  tr
1 Reisebeschreibung útleírás  hu
Mehr
Mehr
Mehr